Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK1 Rabbit Polyclonal Antibody (FITC)

DLK1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DLK, FA1, ZOG, pG2, DLK-1, PREF1, Delta1, Pref-1

UniProt

P80370

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DLK1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Autotaxin/ENPP2 Protein (aa 36-863, His Tag)
PKSH033693-01 10 µg

Recombinant Human Autotaxin/ENPP2 Protein (aa 36-863, His Tag)

Sign In for Pricing
View Details
Recombinant Human Autotaxin/ENPP2 Protein (aa 36-863, His Tag)
PKSH033693-02 50 µg

Recombinant Human Autotaxin/ENPP2 Protein (aa 36-863, His Tag)

Sign In for Pricing
View Details
Mouse IL-2sRβ/CD122 (Soluble Interleukin-2 Receptor) CLIA Kit
E-CL-M0615-01 24 Tests

Mouse IL-2sRβ/CD122 (Soluble Interleukin-2 Receptor) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-2sRβ/CD122 (Soluble Interleukin-2 Receptor) CLIA Kit
E-CL-M0615-02 48 Tests

Mouse IL-2sRβ/CD122 (Soluble Interleukin-2 Receptor) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-2sRβ/CD122 (Soluble Interleukin-2 Receptor) CLIA Kit
E-CL-M0615-03 96 Tests

Mouse IL-2sRβ/CD122 (Soluble Interleukin-2 Receptor) CLIA Kit

Sign In for Pricing
View Details
FUT3 Polyclonal Antibody
E-AB-17979-01 20 µL

FUT3 Polyclonal Antibody

Sign In for Pricing
View Details