Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK1 Rabbit Polyclonal Antibody (HRP)

DLK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DLK, FA1, ZOG, pG2, DLK-1, PREF1, Delta1, Pref-1

UniProt

P80370

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DLK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHIT1 Rabbit Polyclonal Antibody
TA369971 100 µL

CHIT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NQO2 (NM_000904) Human Over-expression Lysate
LY424463 100 µg

NQO2 (NM_000904) Human Over-expression Lysate

Sign In for Pricing
View Details
LLCFC1 (NM_178829) Human Over-expression Lysate
LC432125 20 µg

LLCFC1 (NM_178829) Human Over-expression Lysate

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF640R conjugate, 0.1mg/mL
BNC401687-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cooled Incubator BICL-7906
BICL-7906 1 Unit

Cooled Incubator BICL-7906

Sign In for Pricing
View Details
2',3'-Didehydro-2',3'-dideoxy-5'-acetate Inosine
TRC-D014471-1G 1 g

2',3'-Didehydro-2',3'-dideoxy-5'-acetate Inosine

Sign In for Pricing
View Details