Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX11A Rabbit Polyclonal Antibody (HRP)

PEX11A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PMP28, hsPEX11p, PEX11-ALPHA

UniProt

O75192

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PEX11A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_003838

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD10 Polyclonal Antibody, Biotin Conjugated
A58075-100 100 µL

ANKRD10 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Maltose Binding Protein Antibody
48666-01 50 µL

Maltose Binding Protein Antibody

Sign In for Pricing
View Details
Maltose Binding Protein Antibody
48666-02 100 µL

Maltose Binding Protein Antibody

Sign In for Pricing
View Details
TSC22 domain family, member 4 (TSC22D4) Mouse Monoclonal Antibody [Clone ID: OTI3G6]
TA811733S 30 µL

TSC22 domain family, member 4 (TSC22D4) Mouse Monoclonal Antibody [Clone ID: OTI3G6]

Sign In for Pricing
View Details
Mouse Monoclonal Sirtuin 3/SIRT3 Antibody (6C12D1)
NBP2-52562-0.025mg 0.025 mg

Mouse Monoclonal Sirtuin 3/SIRT3 Antibody (6C12D1)

Sign In for Pricing
View Details
Tmem237 (NM_001108220) Rat Untagged Clone
RN205635 10 µg

Tmem237 (NM_001108220) Rat Untagged Clone

Sign In for Pricing
View Details