Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RL2 Rabbit Polyclonal Antibody (Biotin)

IL1RL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IL-36R, IL1RRP2, IL-1Rrp2, IL1R-rp2

UniProt

Q9HB29

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL1RL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_003845

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-103-1-5p miRNA Inhibitor
MIR01037 2x 5.0 nmol

rno-miR-103-1-5p miRNA Inhibitor

Sign In for Pricing
View Details
Rat FGF19 (Fibroblast Growth Factor 19) ELISA Kit
RE1041R-01 48 Tests

Rat FGF19 (Fibroblast Growth Factor 19) ELISA Kit

Sign In for Pricing
View Details
Rat FGF19 (Fibroblast Growth Factor 19) ELISA Kit
RE1041R-02 96 Tests

Rat FGF19 (Fibroblast Growth Factor 19) ELISA Kit

Sign In for Pricing
View Details
DDX19A Blocking Peptide
33R-4017 100 ug

DDX19A Blocking Peptide

Sign In for Pricing
View Details
Monoclonal CD31 / PECAM-1 (Endothelial Cell Marker) Antibody - Culture Supernatant , Clone: 1A10
AMM01190G 0.05mg

Monoclonal CD31 / PECAM-1 (Endothelial Cell Marker) Antibody - Culture Supernatant , Clone: 1A10

Sign In for Pricing
View Details
MAST1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7257704 1.0 µg DNA

MAST1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details