Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RL2 Rabbit Polyclonal Antibody (Biotin)

IL1RL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IL-36R, IL1RRP2, IL-1Rrp2, IL1R-rp2

UniProt

Q9HB29

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL1RL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_003845

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) Recombinant Mouse Monoclonal Antibody (Clone:rNX2.1/690)
12-1259-20 20 µg

Anti-TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) Recombinant Mouse Monoclonal Antibody (Clone:rNX2.1/690)

Sign In for Pricing
View Details
Goat Fibronectin type III domain-containing protein 7 (FNDC7) ELISA Kit
MBS7233074-01 48 Well

Goat Fibronectin type III domain-containing protein 7 (FNDC7) ELISA Kit

Sign In for Pricing
View Details
Goat Fibronectin type III domain-containing protein 7 (FNDC7) ELISA Kit
MBS7233074-02 96 Well

Goat Fibronectin type III domain-containing protein 7 (FNDC7) ELISA Kit

Sign In for Pricing
View Details
Goat Fibronectin type III domain-containing protein 7 (FNDC7) ELISA Kit
MBS7233074-03 5x 96 Well

Goat Fibronectin type III domain-containing protein 7 (FNDC7) ELISA Kit

Sign In for Pricing
View Details
Goat Fibronectin type III domain-containing protein 7 (FNDC7) ELISA Kit
MBS7233074-04 10x 96 Well

Goat Fibronectin type III domain-containing protein 7 (FNDC7) ELISA Kit

Sign In for Pricing
View Details
SOX4 Rabbit Polyclonal Antibody (HRP)
orb2083061 100 µL

SOX4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details