Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSMR Rabbit Polyclonal Antibody (Biotin)

OSMR Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OSMRB, PLCA1, IL-31RB, OSMRbeta, IL-31R-beta

UniProt

Q99650

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OSMR

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_003990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Very late appearing antigen 4 ELISA Kit
MBS752198-01 48 Well

Porcine Very late appearing antigen 4 ELISA Kit

Sign In for Pricing
View Details
Porcine Very late appearing antigen 4 ELISA Kit
MBS752198-02 96 Well

Porcine Very late appearing antigen 4 ELISA Kit

Sign In for Pricing
View Details
Porcine Very late appearing antigen 4 ELISA Kit
MBS752198-03 5x 96 Well

Porcine Very late appearing antigen 4 ELISA Kit

Sign In for Pricing
View Details
Porcine Very late appearing antigen 4 ELISA Kit
MBS752198-04 10x 96 Well

Porcine Very late appearing antigen 4 ELISA Kit

Sign In for Pricing
View Details
Anti-Nav1.1 Na+ Channel (K74/71) Recombinant Chicken Chimeric mAb (BSA and Azide Free)
78-023-CF 100 µL

Anti-Nav1.1 Na+ Channel (K74/71) Recombinant Chicken Chimeric mAb (BSA and Azide Free)

Sign In for Pricing
View Details
Anti-Fruit fly G6P Antibody Fluoro488 Conjugated
DZ41490-Fluoro488 200 µL/Vial

Anti-Fruit fly G6P Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details