Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH12 Rabbit Polyclonal Antibody (Biotin)

CDH12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDHB

UniProt

P55289

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDH12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin Light Chain 3, Alkali, Ventricular, Slow Skeletal (MYL3) BioAssayTM ELISA Kit (Rat)
589545 96 Tests

Myosin Light Chain 3, Alkali, Ventricular, Slow Skeletal (MYL3) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
APC-Labeled Human CLEC12A / MICL / CLL-1 Protein, His TagStar Staining
CLA-HA244-200tests 200 Tests

APC-Labeled Human CLEC12A / MICL / CLL-1 Protein, His TagStar Staining

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)
MBS7008940-01 0.02 mg

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)
MBS7008940-02 0.1 mg

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)
MBS7008940-03 5x 0.1 mg

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Human TNFRSF10B Protein, mFc Tag
MBS8575127-01 0.01 mg

Human TNFRSF10B Protein, mFc Tag

Sign In for Pricing
View Details