Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCGRT Rabbit Polyclonal Antibody (FITC)

FCGRT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FCRN, alpha-chain

UniProt

P55899

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FCGRT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_004098

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA Kit
MBS7251084-01 48 Well

Guinea pig Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA Kit
MBS7251084-02 96 Well

Guinea pig Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA Kit
MBS7251084-03 5x 96 Well

Guinea pig Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA Kit
MBS7251084-04 10x 96 Well

Guinea pig Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9B) ELISA Kit

Sign In for Pricing
View Details
Human Prostate Lysate Membrane Fraction
MBS8417999-01 0.1 mg

Human Prostate Lysate Membrane Fraction

Sign In for Pricing
View Details
Human Prostate Lysate Membrane Fraction
MBS8417999-02 5x 0.1 mg

Human Prostate Lysate Membrane Fraction

Sign In for Pricing
View Details