Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGQ Rabbit Polyclonal Antibody (HRP)

PIGQ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPI1, DEE77, EIEE77, c407A10.1

UniProt

Q9BRB3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PIGQ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_683721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS640154 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
SLC6A12 (C-term) Goat Polyclonal Antibody
AP32145PU-N 100 µg

SLC6A12 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Human CLDN34 activation kit by CRISPRa
GA119240 1 Kit

Human CLDN34 activation kit by CRISPRa

Sign In for Pricing
View Details
Itaconic Acid
TRC-I931000-5G 5 g

Itaconic Acid

Sign In for Pricing
View Details
P55;50 EBV-Early Antigen (1108-1), Biotin conjugate, 0.1mg/mL
BNCB0103-100 1x 100 µL

P55;50 EBV-Early Antigen (1108-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559122 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details