Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chst2 Rabbit Polyclonal Antibody (Biotin)

Chst2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gn6, GST-, Chts2, GST-2, Gn6st, AI428561, AW121776, GlcNAc6ST, C130041E03Rik

UniProt

Q80WV3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061233

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK15 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
25395154 3x 1.0 µg DNA

KCNK15 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Lentiviral human SPANXN2 shRNA (UAS) - Lentiviral human SPANXN2 shRNA (UAS, iRFP) (100)
GTR15324522 1 Vial

Lentiviral human SPANXN2 shRNA (UAS) - Lentiviral human SPANXN2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Olfactory receptor 2V1 (OR2V1) ELISA Kit
MBS7237421-01 48 Well

Mouse Olfactory receptor 2V1 (OR2V1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 2V1 (OR2V1) ELISA Kit
MBS7237421-02 96 Well

Mouse Olfactory receptor 2V1 (OR2V1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 2V1 (OR2V1) ELISA Kit
MBS7237421-03 5x 96 Well

Mouse Olfactory receptor 2V1 (OR2V1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 2V1 (OR2V1) ELISA Kit
MBS7237421-04 10x 96 Well

Mouse Olfactory receptor 2V1 (OR2V1) ELISA Kit

Sign In for Pricing
View Details