Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chst2 Rabbit Polyclonal Antibody (HRP)

Chst2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gn6, GST-, Chts2, GST-2, Gn6st, AI428561, AW121776, GlcNAc6ST, C130041E03Rik

UniProt

Q80WV3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061233

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SNUPN Pre-designed siRNA Set A
SI015445A 1 Each

Human SNUPN Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Basic leucine zipper transcriptional factor ATF-like 3, BATF3 ELISA Kit
MBS9337038-01 48 Well

Human Basic leucine zipper transcriptional factor ATF-like 3, BATF3 ELISA Kit

Sign In for Pricing
View Details
Human Basic leucine zipper transcriptional factor ATF-like 3, BATF3 ELISA Kit
MBS9337038-02 96 Well

Human Basic leucine zipper transcriptional factor ATF-like 3, BATF3 ELISA Kit

Sign In for Pricing
View Details
Human Basic leucine zipper transcriptional factor ATF-like 3, BATF3 ELISA Kit
MBS9337038-03 5x 96 Well

Human Basic leucine zipper transcriptional factor ATF-like 3, BATF3 ELISA Kit

Sign In for Pricing
View Details
Human Basic leucine zipper transcriptional factor ATF-like 3, BATF3 ELISA Kit
MBS9337038-04 10x 96 Well

Human Basic leucine zipper transcriptional factor ATF-like 3, BATF3 ELISA Kit

Sign In for Pricing
View Details
CHEK2 Antibody
orb571836 100 µL

CHEK2 Antibody

Sign In for Pricing
View Details