Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST2 Rabbit Polyclonal Antibody (FITC)

CHST2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C6ST, GST2, GST-2, Gn6ST-1, HEL-S-75, glcNAc6ST-1

UniProt

Q9Y4C5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHST2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-Human Papilloma Virus 11 late protein L1 (HPV6L11) IgG negative/low positive control serum
550-011-NPC 1 ml

Human Anti-Human Papilloma Virus 11 late protein L1 (HPV6L11) IgG negative/low positive control serum

Sign In for Pricing
View Details
Anti-GBA2 Antibody Picoband®, APC Conjugate
A08047-1-APC 100 µg/Vial

Anti-GBA2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Human Keratin-associated protein 27-1, KRTAP27-1 ELISA KIT
ELI-19296h 96 Tests

Human Keratin-associated protein 27-1, KRTAP27-1 ELISA KIT

Sign In for Pricing
View Details
ETS1 Polyclonal Antibody
A72413-100 100 µL

ETS1 Polyclonal Antibody

Sign In for Pricing
View Details
PEnCMV-RCN2 (human) -3xMyc-SV40-Neo (1Synonymous mutation)
BZ37686 1 Vial

PEnCMV-RCN2 (human) -3xMyc-SV40-Neo (1Synonymous mutation)

Sign In for Pricing
View Details
Recombinant Human BAZ2B
MBS7611615-01 0.05 mg

Recombinant Human BAZ2B

Sign In for Pricing
View Details