Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST2 Rabbit Polyclonal Antibody (HRP)

CHST2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C6ST, GST2, GST-2, Gn6ST-1, HEL-S-75, glcNAc6ST-1

UniProt

Q9Y4C5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHST2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CCL23/Ck beta 8-1/MIP3 Antibody (CCL23/4034)
NBP3-26727-20ug 20 µg

Mouse Monoclonal CCL23/Ck beta 8-1/MIP3 Antibody (CCL23/4034)

Sign In for Pricing
View Details
Stabilin 2 Rabbit Polyclonal Antibody (Cy5.5)
orb1057140 100 µL

Stabilin 2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Smad2/3 and Smad1/5/8 ELISA Kit (Colorimetric)
TE-0015 96 Samples

Smad2/3 and Smad1/5/8 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Human C1orf94 activation kit by CRISPRa
GA113810 1 Kit

Human C1orf94 activation kit by CRISPRa

Sign In for Pricing
View Details
Chicken intercellular adhesion molecule 3 ELISA Kit
MBS735355-01 48 Well

Chicken intercellular adhesion molecule 3 ELISA Kit

Sign In for Pricing
View Details
Chicken intercellular adhesion molecule 3 ELISA Kit
MBS735355-02 96 Well

Chicken intercellular adhesion molecule 3 ELISA Kit

Sign In for Pricing
View Details