Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dag1 Rabbit Polyclonal Antibody (HRP)

Dag1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DG, Dp71, Dp427, D9Wsu13, D9Wsu13e

UniProt

Q62165

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Chicken CD28 Monoclonal Antibody-[FITC]
VD7N268 1 Each

Mouse Anti-Chicken CD28 Monoclonal Antibody-[FITC]

Sign In for Pricing
View Details
Phospho-TGF beta Receptor II (Ser225) Recombinant Rabbit mAb
BS43286-01 50 µL

Phospho-TGF beta Receptor II (Ser225) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-TGF beta Receptor II (Ser225) Recombinant Rabbit mAb
BS43286-02 100 µL

Phospho-TGF beta Receptor II (Ser225) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-DNA PKcs (Thr2638) Rabbit pAb, PerCP-Cy7 conjugated
orb2879864 100 µL

Phospho-DNA PKcs (Thr2638) Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Fritillaria agrestis Plastocyanin, chloroplastic (PETE)
MBS1122818-01 0.02 mg (E-Coli)

Recombinant Fritillaria agrestis Plastocyanin, chloroplastic (PETE)

Sign In for Pricing
View Details
Recombinant Fritillaria agrestis Plastocyanin, chloroplastic (PETE)
MBS1122818-02 0.1 mg (E-Coli)

Recombinant Fritillaria agrestis Plastocyanin, chloroplastic (PETE)

Sign In for Pricing
View Details