Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1 Rabbit Polyclonal Antibody (HRP)

ECM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URBWD

UniProt

Q16610

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ECM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSH

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_073155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF5 (Interferon Regulatory Factor 5, SLEB10)
247720 100 µg

IRF5 (Interferon Regulatory Factor 5, SLEB10)

Sign In for Pricing
View Details
BDMR Protein Vector (Human) (pPM-N-D-C-His)
PV326725 500 ng

BDMR Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
NHEDC2, CT (SLC9B2, NHA2, NHEDC2, Mitochondrial sodium/hydrogen exchanger 9B2, Mitochondrial Na (+) /H (+) exchanger NHA2, Na (+) /H (+) exchanger-like domain-containing protein 2, Sodium/hydrogen exchanger-like domain-containing protein 2, Solute carrier family 9 subfamily B member 2) (FITC) discontinued
038959-FITC 200 µL

NHEDC2, CT (SLC9B2, NHA2, NHEDC2, Mitochondrial sodium/hydrogen exchanger 9B2, Mitochondrial Na (+) /H (+) exchanger NHA2, Na (+) /H (+) exchanger-like domain-containing protein 2, Sodium/hydrogen exchanger-like domain-containing protein 2, Solute carrier family 9 subfamily B member 2) (FITC) discontinued

Sign In for Pricing
View Details
MTX2 Antibody (Center)
MBS9209714-01 0.08 mL

MTX2 Antibody (Center)

Sign In for Pricing
View Details
MTX2 Antibody (Center)
MBS9209714-02 0.4 mL

MTX2 Antibody (Center)

Sign In for Pricing
View Details
MTX2 Antibody (Center)
MBS9209714-03 5x 0.4 mL

MTX2 Antibody (Center)

Sign In for Pricing
View Details