Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFD2 Rabbit Polyclonal Antibody (Biotin)

MTHFD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NMDMC

UniProt

P13995

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COASY Antibody
OACA09893-50UG 50 µg

COASY Antibody

Sign In for Pricing
View Details
Mouse ES Cell Culture Media
M16101 500 mL

Mouse ES Cell Culture Media

Sign In for Pricing
View Details
ELISA Kit for Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1)
TRV-0044867-01 24 Tests

ELISA Kit for Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1)

Sign In for Pricing
View Details
ELISA Kit for Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1)
TRV-0044867-02 48 Tests

ELISA Kit for Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1)

Sign In for Pricing
View Details
ELISA Kit for Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1)
TRV-0044867-03 96 Tests

ELISA Kit for Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1)

Sign In for Pricing
View Details
ELISA Kit for Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1)
TRV-0044867-04 5x 96 Tests

ELISA Kit for Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1)

Sign In for Pricing
View Details