Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIP1 Rabbit Polyclonal Antibody (HRP)

STIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521

UniProt

P31948

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human STIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006810

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHST11 Polyclonal Antibody, RBITC Conjugated
bs-13930R-RBITC 100 µL

CHST11 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
SNX14 Protein Vector (Mouse) (pPM-C-His)
PV232457 500 ng

SNX14 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Bovine Anti-Bullous Pemphigoid 180 Antibody BP180-Ab ELISA Kit
BG-BVN10400 1 Each

Bovine Anti-Bullous Pemphigoid 180 Antibody BP180-Ab ELISA Kit

Sign In for Pricing
View Details
CCL19 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV651719 1.0 µg DNA

CCL19 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rabbit Ubiquitin Carboxyl-Terminal Hydrolase 35 (USP35) ELISA Kit
MBS9927492 Inquire

Rabbit Ubiquitin Carboxyl-Terminal Hydrolase 35 (USP35) ELISA Kit

Sign In for Pricing
View Details
GABARAP (Gamma-aminobutyric Acid Receptor-associated Protein-like 2, MM46, ATG8A, GABARAP-a) discontinued
210926-01 20 µL

GABARAP (Gamma-aminobutyric Acid Receptor-associated Protein-like 2, MM46, ATG8A, GABARAP-a) discontinued

Sign In for Pricing
View Details