Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL15 Rabbit Polyclonal Antibody (HRP)

MRPL15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L15mt, RPML7, MRP-L7, HSPC145, MRP-L15

UniProt

Q9P015

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054894

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRX84 Protein Vector (Human) (pPM-C-His)
PV101589 500 ng

MRX84 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Canine P2Y purinoceptor 2 (P2RY2) ELISA Kit
MBS7250280-01 48 Well

Canine P2Y purinoceptor 2 (P2RY2) ELISA Kit

Sign In for Pricing
View Details
Canine P2Y purinoceptor 2 (P2RY2) ELISA Kit
MBS7250280-02 96 Well

Canine P2Y purinoceptor 2 (P2RY2) ELISA Kit

Sign In for Pricing
View Details
Canine P2Y purinoceptor 2 (P2RY2) ELISA Kit
MBS7250280-03 5x 96 Well

Canine P2Y purinoceptor 2 (P2RY2) ELISA Kit

Sign In for Pricing
View Details
Canine P2Y purinoceptor 2 (P2RY2) ELISA Kit
MBS7250280-04 10x 96 Well

Canine P2Y purinoceptor 2 (P2RY2) ELISA Kit

Sign In for Pricing
View Details
G6PD, ID (G6PD, Glucose-6-phosphate 1-dehydrogenase) (MaxLight 750) discontinued
035829-ML750 100 µL

G6PD, ID (G6PD, Glucose-6-phosphate 1-dehydrogenase) (MaxLight 750) discontinued

Sign In for Pricing
View Details