Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL15 Rabbit Polyclonal Antibody (Biotin)

MRPL15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L15mt, RPML7, MRP-L7, HSPC145, MRP-L15

UniProt

Q9P015

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MRPL15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYTS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054894

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2344805 3x 1.0 µg

TBX15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Donkey Spondin 1 ELISA Kit
MBS101776 Inquire

Donkey Spondin 1 ELISA Kit

Sign In for Pricing
View Details
Slc2a3 3'UTR GFP Stable Cell Line
TU169059 1.0 mL

Slc2a3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PLK4 (NM_014264) Human Tagged Lenti ORF Clone
RC206015L3 10 µg

PLK4 (NM_014264) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CCDC137P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0385707 1.0 µg DNA

CCDC137P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human BMF protein
MBS1561438-01 0.05 mg

Recombinant Human BMF protein

Sign In for Pricing
View Details