Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Melk Rabbit Polyclonal Antibody (FITC)

Melk Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MPK3, MPK38, AI327312, mKIAA0175

UniProt

Q61846

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Melk

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHIC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GADL1 Protein Lysate (Human) with C-Ha Tag
21178031 100 µg

GADL1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Human Isoprenaline Hydrochloride (iso-Hyd) ELISA Kit
GA-E1045HM-01 48 Tests

Human Isoprenaline Hydrochloride (iso-Hyd) ELISA Kit

Sign In for Pricing
View Details
Human Isoprenaline Hydrochloride (iso-Hyd) ELISA Kit
GA-E1045HM-02 96 Tests

Human Isoprenaline Hydrochloride (iso-Hyd) ELISA Kit

Sign In for Pricing
View Details
LOC500956 Protein Vector (Rat) (pPM-C-HA)
27306026 500 ng

LOC500956 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Eed shRNA (UAS) - Lentiviral mouse Eed shRNA (UAS) (100)
GTR15255666 1 Vial

Lentiviral mouse Eed shRNA (UAS) - Lentiviral mouse Eed shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica Protein grpE (grpE)
MBS1162696-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. holarctica Protein grpE (grpE)

Sign In for Pricing
View Details