Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SWAP70 Rabbit Polyclonal Antibody (Biotin)

SWAP70 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSPC321, SWAP-70

UniProt

Q9UH65

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SWAP70

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055870

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCHSD2 shRNA (m) Lentiviral Particles
sc-145151-V 200 µL

FCHSD2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Lentiviral mouse Fcnb shRNA (UAS) - Lentiviral mouseFcnb shRNA (UAS, GFP) (25)
GTR15259340 1 Vial

Lentiviral mouse Fcnb shRNA (UAS) - Lentiviral mouseFcnb shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SET Protein Lysate (Human) with C-Ha Tag
43518031 100 µg

SET Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Gm16501 sgRNA CRISPR Lentivector set (Mouse)
K3084001 3x 1.0 µg

Gm16501 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PUS7L Polyclonal Conjugated Antibody
MBS9441353-01 0.1 mL (Biotin)

PUS7L Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
PUS7L Polyclonal Conjugated Antibody
MBS9441353-02 0.1 mL (AF350)

PUS7L Polyclonal Conjugated Antibody

Sign In for Pricing
View Details