Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GINS2 Rabbit Polyclonal Antibody (HRP)

GINS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSF2, Pfs2, HSPC037

UniProt

Q9Y248

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GINS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057179

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf28 AAV Vector (Human) (CMV)
17195101 1 µg

CXorf28 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PTGR2 Protein Vector (Rat) (pPM-C-HA)
PV297124 500 ng

PTGR2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
8 cap strip, PCR, polypropylene, red, convex top side, for 673273, 1.250 pieces per CAR
373273 1.250 pieces per CAR

8 cap strip, PCR, polypropylene, red, convex top side, for 673273, 1.250 pieces per CAR

Sign In for Pricing
View Details
Anti - NaPi-1 (Npt1)
MBS616194-01 0.1 mL

Anti - NaPi-1 (Npt1)

Sign In for Pricing
View Details
Anti - NaPi-1 (Npt1)
MBS616194-02 5x 0.1 mL

Anti - NaPi-1 (Npt1)

Sign In for Pricing
View Details
1-Hexyl-3-(1-naphthoyl)indoleJWH 19
TRC-H296800-25MG 25 mg

1-Hexyl-3-(1-naphthoyl)indoleJWH 19

Sign In for Pricing
View Details