Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRTO4 Rabbit Polyclonal Antibody (HRP)

MRTO4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRT4, C1orf33, dJ657E11.4

UniProt

Q9UKD2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRTO4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057267

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1466208 1.0 µg DNA

NUDT17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral human MED13 shRNA (UAS) - Lentiviral human MED13 shRNA (UAS, RFP) (100)
GTR15288612 1 Vial

Lentiviral human MED13 shRNA (UAS) - Lentiviral human MED13 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Guinea pig thyroxine, T4 ELISA KIT
EA0013Gp-01 96 Well

Guinea pig thyroxine, T4 ELISA KIT

Sign In for Pricing
View Details
Guinea pig thyroxine, T4 ELISA KIT
EA0013Gp-02 5x 96 Tests

Guinea pig thyroxine, T4 ELISA KIT

Sign In for Pricing
View Details
Guinea pig thyroxine, T4 ELISA KIT
EA0013Gp-03 10x 96 Tests

Guinea pig thyroxine, T4 ELISA KIT

Sign In for Pricing
View Details
Perm1 Mouse shRNA Plasmid (Locus ID 74183)
TL511729 1 Kit

Perm1 Mouse shRNA Plasmid (Locus ID 74183)

Sign In for Pricing
View Details