Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUSAP1 Rabbit Polyclonal Antibody (FITC)

NUSAP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LNP, ANKT, SAPL, BM037, NUSAP, Q0310, PRO0310p1

UniProt

Q9BXS6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NUSAP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HFEEHNSMNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGP

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MAP7D2 Antibody [FITC]
NBP2-97908F 0.1 mL

Rabbit Polyclonal MAP7D2 Antibody [FITC]

Sign In for Pricing
View Details
NME1, NT (NM23A, NME/NM23 nucleoside diphosphate kinase 1, Non-metastatic cells 1, NM23, NM23-H1, NDPKA, GAAD, AWD, Granzyme A-activated DNase)
350758 100 µg

NME1, NT (NM23A, NME/NM23 nucleoside diphosphate kinase 1, Non-metastatic cells 1, NM23, NM23-H1, NDPKA, GAAD, AWD, Granzyme A-activated DNase)

Sign In for Pricing
View Details
Rabbit Polyclonal ACADL Antibody [Alexa Fluor 647]
NBP2-97409AF647 0.1 mL

Rabbit Polyclonal ACADL Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Klri1 Protein Lysate (Rat) with C-HA Tag
25887036 100 µg

Klri1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
CD80 Recombinant Antibody, APC Conjugated
bsm-61404R-APC-TR 20 µL

CD80 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
SERGEF Human shRNA Plasmid Kit (Locus ID 26297)
TL309545 1 Kit

SERGEF Human shRNA Plasmid Kit (Locus ID 26297)

Sign In for Pricing
View Details