Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL39 Rabbit Polyclonal Antibody (FITC)

MRPL39 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L5mt, L39mt, MRPL5, RPML5, MRP-L5, PRED22, PRED66, MSTP003, C21orf92

UniProt

Q9NYK5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL39

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGL3-Basic-NPPA promoter
PPL00263-4a 1 Each

PGL3-Basic-NPPA promoter

Sign In for Pricing
View Details
VANGL2, NT (VANGL2, KIAA1215, STB1, Vang-like protein 2, Loop-tail protein 1 homolog, Strabismus 1, Van Gogh-like protein 2) (PE)
MBS6362234-01 0.2 mL

VANGL2, NT (VANGL2, KIAA1215, STB1, Vang-like protein 2, Loop-tail protein 1 homolog, Strabismus 1, Van Gogh-like protein 2) (PE)

Sign In for Pricing
View Details
VANGL2, NT (VANGL2, KIAA1215, STB1, Vang-like protein 2, Loop-tail protein 1 homolog, Strabismus 1, Van Gogh-like protein 2) (PE)
MBS6362234-02 5x 0.2 mL

VANGL2, NT (VANGL2, KIAA1215, STB1, Vang-like protein 2, Loop-tail protein 1 homolog, Strabismus 1, Van Gogh-like protein 2) (PE)

Sign In for Pricing
View Details
FOXK1 Antibody
DF3231-01 100 µL

FOXK1 Antibody

Sign In for Pricing
View Details
FOXK1 Antibody
DF3231-02 200 µL

FOXK1 Antibody

Sign In for Pricing
View Details
FGFR1a Recombinant Protein
orb1230452 10 µg

FGFR1a Recombinant Protein

Sign In for Pricing
View Details