Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP55 Rabbit Polyclonal Antibody (FITC)

CEP55 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CT111, MARCH, URCC6, C10orf3

UniProt

Q53EZ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CEP55

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-B, BCLB) (MaxLight 405) discontinued
123883-ML405 100 µL

BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-B, BCLB) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human liver FABP (FABP1) activation kit by CRISPRa
GA101511 1 Kit

Human liver FABP (FABP1) activation kit by CRISPRa

Sign In for Pricing
View Details
PRDM4 (PR Domain Containing 4, MGC45046, PFM1) (APC)
MBS6167552-01 0.1 mL

PRDM4 (PR Domain Containing 4, MGC45046, PFM1) (APC)

Sign In for Pricing
View Details
PRDM4 (PR Domain Containing 4, MGC45046, PFM1) (APC)
MBS6167552-02 5x 0.1 mL

PRDM4 (PR Domain Containing 4, MGC45046, PFM1) (APC)

Sign In for Pricing
View Details
Mouse Monoclonal TRA-1-85/CD147 Antibody (TRA-1-85) [HRP]
FAB3195H 0.1 mL

Mouse Monoclonal TRA-1-85/CD147 Antibody (TRA-1-85) [HRP]

Sign In for Pricing
View Details
TM4SF5 Protein Lysate (Human) with C-Ha Tag
46799031 100 µg

TM4SF5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details