Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP55 Rabbit Polyclonal Antibody (FITC)

CEP55 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CT111, MARCH, URCC6, C10orf3

UniProt

Q53EZ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CEP55

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mbp (NM_001025291) AAV Particle
RR200503A1V 250 µL

Rat Mbp (NM_001025291) AAV Particle

Sign In for Pricing
View Details
Recombinant Saccharum hybrid Photosystem II reaction center protein Z (psbZ), partial
MBS7087351 Inquire

Recombinant Saccharum hybrid Photosystem II reaction center protein Z (psbZ), partial

Sign In for Pricing
View Details
Klra33 (NM_001039118) Mouse Tagged ORF Clone Lentiviral Particle
MR213198L3V 200 µL

Klra33 (NM_001039118) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial/MECR (C-6His)
C917-10ug 10 µg

Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial/MECR (C-6His)

Sign In for Pricing
View Details
RNF13 Protein Lysate (Rat) with C-HA Tag
40245036 100 µg

RNF13 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Human Carbonyl reductase [NADPH] 3 (CBR3) ELISA Kit
AE59162HU-01 48 Tests

Human Carbonyl reductase [NADPH] 3 (CBR3) ELISA Kit

Sign In for Pricing
View Details