Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP55 Rabbit Polyclonal Antibody (HRP)

CEP55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT111, MARCH, URCC6, C10orf3

UniProt

Q53EZ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CEP55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrap3 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-6991R-PE-Cy5.5 100 µL

Thrap3 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
RGS13 Rabbit Polyclonal Antibody
orb329758 100 µL

RGS13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aly Rabbit mAb
E60M3208 100 µL

Aly Rabbit mAb

Sign In for Pricing
View Details
Human NEK4 activation kit by CRISPRa
GA104673 1 Kit

Human NEK4 activation kit by CRISPRa

Sign In for Pricing
View Details
RPC8 Antibody
E19-4007 100 µg -100 µL

RPC8 Antibody

Sign In for Pricing
View Details
Dnajc4 ORF Vector (Rat) (pORF)
18413016 1.0 µg DNA

Dnajc4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details