Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP55 Rabbit Polyclonal Antibody (HRP)

CEP55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT111, MARCH, URCC6, C10orf3

UniProt

Q53EZ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CEP55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEB3B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46369111 3x 1.0 µg

TCEB3B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ZPLD1 Human qPCR Primer Pair (NM_175056)
HP218603 200 Reactions

ZPLD1 Human qPCR Primer Pair (NM_175056)

Sign In for Pricing
View Details
QRFPR, ID (QRFPR, GPR103, Pyroglutamylated RFamide peptide receptor, AQ27, G-protein coupled receptor 103, Orexigenic neuropeptide QRFP receptor, SP9155) (Azide free) (HRP)
MBS6339452-01 0.2 mL

QRFPR, ID (QRFPR, GPR103, Pyroglutamylated RFamide peptide receptor, AQ27, G-protein coupled receptor 103, Orexigenic neuropeptide QRFP receptor, SP9155) (Azide free) (HRP)

Sign In for Pricing
View Details
QRFPR, ID (QRFPR, GPR103, Pyroglutamylated RFamide peptide receptor, AQ27, G-protein coupled receptor 103, Orexigenic neuropeptide QRFP receptor, SP9155) (Azide free) (HRP)
MBS6339452-02 5x 0.2 mL

QRFPR, ID (QRFPR, GPR103, Pyroglutamylated RFamide peptide receptor, AQ27, G-protein coupled receptor 103, Orexigenic neuropeptide QRFP receptor, SP9155) (Azide free) (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal VNN2 Antibody (3F8F8H6) [Alexa Fluor 750]
NBP3-06441AF750 0.1 mL

Mouse Monoclonal VNN2 Antibody (3F8F8H6) [Alexa Fluor 750]

Sign In for Pricing
View Details
CARM1 Antibody - middle region
OABB01428-100UG 100 µg/Vial

CARM1 Antibody - middle region

Sign In for Pricing
View Details