Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP55 Rabbit Polyclonal Antibody (Biotin)

CEP55 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CT111, MARCH, URCC6, C10orf3

UniProt

Q53EZ4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CEP55

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E. coli OmpC
117098 100 µg

E. coli OmpC

Sign In for Pricing
View Details
Anti-PD-L1 Antibody, Rabbit Polyclonal
MBS8110760-01 0.1 mL

Anti-PD-L1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-PD-L1 Antibody, Rabbit Polyclonal
MBS8110760-02 5x 0.1 mL

Anti-PD-L1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Transcription Elongation Factor A2 (TCEA2)
MBS2116251-01 0.1 mL

HRP-Linked Polyclonal Antibody to Transcription Elongation Factor A2 (TCEA2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Transcription Elongation Factor A2 (TCEA2)
MBS2116251-02 0.2 mL

HRP-Linked Polyclonal Antibody to Transcription Elongation Factor A2 (TCEA2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Transcription Elongation Factor A2 (TCEA2)
MBS2116251-03 0.5 mL

HRP-Linked Polyclonal Antibody to Transcription Elongation Factor A2 (TCEA2)

Sign In for Pricing
View Details