Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Interleukin-23 subunit alpha (IL23A)

Product Specifications

Product Name Alternative

Interleukin-23 subunit p19 (IL-23p19)

Abbreviation

Recombinant Pig IL23A protein

Gene Name

IL23A

UniProt

Q9N2H9

Expression Region

23-193aa

Organism

Sus scrofa (Pig)

Target Sequence

RAVPEGSSPAWAQGQQLSQQLCTLAWTAHLPMGHVDLPREEGDDETTSEVPHIQCGDGCDPQGLRDNSQSCLQRIHQGLVFYEKLLGSDIFTGEPSLHPDGSVGQLHASLLGLRQLLQPEGHHWETEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGAATLSQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

In vitro E.coli expression system

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-miR-144-5p Virus
mh1612 250 µL

AdmiRa-hsa-miR-144-5p Virus

Sign In for Pricing
View Details
P2RY11 Rabbit pAb
orb2718211-01 50 µL

P2RY11 Rabbit pAb

Sign In for Pricing
View Details
P2RY11 Rabbit pAb
orb2718211-02 100 µL

P2RY11 Rabbit pAb

Sign In for Pricing
View Details
CEP131 Rabbit Polyclonal Antibody
orb318991-01 30 µL

CEP131 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEP131 Rabbit Polyclonal Antibody
orb318991-02 50 μL

CEP131 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEP131 Rabbit Polyclonal Antibody
orb318991-03 100 µL

CEP131 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details