CLPS, Human (sf9, His)
CLPS or colipase is an important cofactor for pancreatic lipase that helps anchor it at the lipid-water interface. In the absence of colipase, pancreatic lipase is easily washed away by bile salts, which inhibit the enzyme. CLPS Protein, Human (sf9, His) is the recombinant human-derived CLPS protein, expressed by Sf9 insect cells , with C-His labeled tag.
Product Specifications
Product Name Alternative
CLPS Protein, Human (sf9, His), Human, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/clps-protein-human-sf9-his.html
Purity
90.00
Smiles
APGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
Molecular Formula
1208 (Gene_ID) P04118 (A18-Q112) (Accession)
Molecular Weight
Approximately 12 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
HTRA2 (OMI, PRSS25, Serine Protease HTRA2, Mitochondrial, High Temperature Requirement Protein A2, Omi Stress-regulated Endoprotease, Serine Protease 25, Serine Proteinase OMI) (MaxLight 650)
HTRA2 (OMI, PRSS25, Serine Protease HTRA2, Mitochondrial, High Temperature Requirement Protein A2, Omi Stress-regulated Endoprotease, Serine Protease 25, Serine Proteinase OMI) (MaxLight 650)