Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIT2 Rabbit Polyclonal Antibody (HRP)

NIT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEL-S-8a

UniProt

Q9NQR4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NIT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064587

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Diethyl Dithiocarbamate Trihydrate AR/ACS
1191030 100 100 g

Sodium Diethyl Dithiocarbamate Trihydrate AR/ACS

Sign In for Pricing
View Details
Gm10922 Protein Lysate (Mouse) with C-HA Tag
21717034 100 µg

Gm10922 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
P4HB (Cellular Thyroid Hormone Binding Protein, Cellular Thyroid Hormone-Binding Protein, Collagen prolyl 4 hydroxylase beta, Disulphide Isomerase, DSI, EC 5.3.4.1, Endoplasmic Reticulum resident Protein 59, ER Protein 59, ERBA2L, ERp59, GIT, Gltathione insulin Transhydrogenase, Glutathione insulin Transhydrogenase, P4HB, P4Hbeta, p55, PDI, PDIA1, PDIA1, PDIR, PHDB, PO4DB, PO4HB, Procollagen proline 2 oxoglutarate 4 dioxygenase (proline 4 hydroxylase) beta Polypeptide (pro) discontinued
224773-01 50 µL

P4HB (Cellular Thyroid Hormone Binding Protein, Cellular Thyroid Hormone-Binding Protein, Collagen prolyl 4 hydroxylase beta, Disulphide Isomerase, DSI, EC 5.3.4.1, Endoplasmic Reticulum resident Protein 59, ER Protein 59, ERBA2L, ERp59, GIT, Gltathione insulin Transhydrogenase, Glutathione insulin Transhydrogenase, P4HB, P4Hbeta, p55, PDI, PDIA1, PDIA1, PDIR, PHDB, PO4DB, PO4HB, Procollagen proline 2 oxoglutarate 4 dioxygenase (proline 4 hydroxylase) beta Polypeptide (pro) discontinued

Sign In for Pricing
View Details
P4HB (Cellular Thyroid Hormone Binding Protein, Cellular Thyroid Hormone-Binding Protein, Collagen prolyl 4 hydroxylase beta, Disulphide Isomerase, DSI, EC 5.3.4.1, Endoplasmic Reticulum resident Protein 59, ER Protein 59, ERBA2L, ERp59, GIT, Gltathione insulin Transhydrogenase, Glutathione insulin Transhydrogenase, P4HB, P4Hbeta, p55, PDI, PDIA1, PDIA1, PDIR, PHDB, PO4DB, PO4HB, Procollagen proline 2 oxoglutarate 4 dioxygenase (proline 4 hydroxylase) beta Polypeptide (pro) discontinued
224773-02 100 µL

P4HB (Cellular Thyroid Hormone Binding Protein, Cellular Thyroid Hormone-Binding Protein, Collagen prolyl 4 hydroxylase beta, Disulphide Isomerase, DSI, EC 5.3.4.1, Endoplasmic Reticulum resident Protein 59, ER Protein 59, ERBA2L, ERp59, GIT, Gltathione insulin Transhydrogenase, Glutathione insulin Transhydrogenase, P4HB, P4Hbeta, p55, PDI, PDIA1, PDIA1, PDIR, PHDB, PO4DB, PO4HB, Procollagen proline 2 oxoglutarate 4 dioxygenase (proline 4 hydroxylase) beta Polypeptide (pro) discontinued

Sign In for Pricing
View Details
Guinea Pig Factor VIII related antigen ELISA Kit
MBS729200-01 48 Well

Guinea Pig Factor VIII related antigen ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Factor VIII related antigen ELISA Kit
MBS729200-02 96 Well

Guinea Pig Factor VIII related antigen ELISA Kit

Sign In for Pricing
View Details