Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GINS1 Rabbit Polyclonal Antibody (FITC)

GINS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PSF1, IMD55

UniProt

Q14691

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GINS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066545

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (MaxLight 490)
133126-ML490 100 µL

SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (MaxLight 490)

Sign In for Pricing
View Details
CD62L (gp90 MEL, hLHRc, L Selectin, L-Selectin, LSEL, Leukocyte Adhesion Molecule 1, LAM1, Leukocyte Endothelial Cell Adhesion Molecule 1, LECAM1, LECAM-1, Lymph Node Homing Receptor, LNHR, Lymphocyte Adhesion Molecule 1, LYAM1, PLNHR, Selectin L, SELL, TQ1) (MaxLight 490) discontinued
C2415-31L-ML490 100 µL

CD62L (gp90 MEL, hLHRc, L Selectin, L-Selectin, LSEL, Leukocyte Adhesion Molecule 1, LAM1, Leukocyte Endothelial Cell Adhesion Molecule 1, LECAM1, LECAM-1, Lymph Node Homing Receptor, LNHR, Lymphocyte Adhesion Molecule 1, LYAM1, PLNHR, Selectin L, SELL, TQ1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Progesterone
A8509-25 25 mg

Progesterone

Sign In for Pricing
View Details
RT4I1, CT (RTN4IP1, NIMP, Reticulon-4-interacting protein 1, mitochondrial, NOGO-interacting mitochondrial protein) (Azide free) (HRP) discontinued
041315-HRP 200 µL

RT4I1, CT (RTN4IP1, NIMP, Reticulon-4-interacting protein 1, mitochondrial, NOGO-interacting mitochondrial protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
GNAL Rabbit Polyclonal Antibody (Fluoro647)
orb3097447 100 µg

GNAL Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Human Receptor II for the Fc region of immunoglobulin E, FcεRII ELISA Kit
SL1514Hu-01 48 Tests

Human Receptor II for the Fc region of immunoglobulin E, FcεRII ELISA Kit

Sign In for Pricing
View Details