Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GINS1 Rabbit Polyclonal Antibody (HRP)

GINS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSF1, IMD55

UniProt

Q14691

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GINS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066545

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srpa-68 Antibody
orb802480 2 mg

Srpa-68 Antibody

Sign In for Pricing
View Details
IQCA1 Rabbit Polyclonal Antibody (Biotin)
orb445807 100 µL

IQCA1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CADM3, ID (CADM3, IGSF4B, NECL1, SYNCAM3, TSLL1, Cell adhesion molecule 3, Brain immunoglobulin receptor, Immunoglobulin superfamily member 4B, Nectin-like protein 1, Synaptic cell adhesion molecule 3, TSLC1-like protein 1) (PE)
MBS6280473-01 0.2 mL

CADM3, ID (CADM3, IGSF4B, NECL1, SYNCAM3, TSLL1, Cell adhesion molecule 3, Brain immunoglobulin receptor, Immunoglobulin superfamily member 4B, Nectin-like protein 1, Synaptic cell adhesion molecule 3, TSLC1-like protein 1) (PE)

Sign In for Pricing
View Details
CADM3, ID (CADM3, IGSF4B, NECL1, SYNCAM3, TSLL1, Cell adhesion molecule 3, Brain immunoglobulin receptor, Immunoglobulin superfamily member 4B, Nectin-like protein 1, Synaptic cell adhesion molecule 3, TSLC1-like protein 1) (PE)
MBS6280473-02 5x 0.2 mL

CADM3, ID (CADM3, IGSF4B, NECL1, SYNCAM3, TSLL1, Cell adhesion molecule 3, Brain immunoglobulin receptor, Immunoglobulin superfamily member 4B, Nectin-like protein 1, Synaptic cell adhesion molecule 3, TSLC1-like protein 1) (PE)

Sign In for Pricing
View Details
Boc-O-acetyl-L-serine dicyclohexylammonium salt ≥95% (HPLC)
236580-01 100 mg

Boc-O-acetyl-L-serine dicyclohexylammonium salt ≥95% (HPLC)

Sign In for Pricing
View Details
Boc-O-acetyl-L-serine dicyclohexylammonium salt ≥95% (HPLC)
236580-02 250 mg

Boc-O-acetyl-L-serine dicyclohexylammonium salt ≥95% (HPLC)

Sign In for Pricing
View Details