Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMT1 Rabbit Polyclonal Antibody (FITC)

NMT1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NMT

UniProt

P30419

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NMT1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GINS2 antibody - N-terminal region (ARP46238_P050)
ARP46238_P050 100 µL

GINS2 antibody - N-terminal region (ARP46238_P050)

Sign In for Pricing
View Details
Human Nuclear factor-kappa B (NF-κB) ELISA Kit
AE31148HU-01 48 Tests

Human Nuclear factor-kappa B (NF-κB) ELISA Kit

Sign In for Pricing
View Details
Human Nuclear factor-kappa B (NF-κB) ELISA Kit
AE31148HU-02 96 Tests

Human Nuclear factor-kappa B (NF-κB) ELISA Kit

Sign In for Pricing
View Details
MRP8/14 (S100A8/A9) Mouse Monoclonal Antibody [Clone ID: FP 64]
AM31907PU-N 100 µg

MRP8/14 (S100A8/A9) Mouse Monoclonal Antibody [Clone ID: FP 64]

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Major Histocompatibility Complex Class II DR Alpha (MHCDRa)
MBS2063655-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Major Histocompatibility Complex Class II DR Alpha (MHCDRa)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Major Histocompatibility Complex Class II DR Alpha (MHCDRa)
MBS2063655-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Major Histocompatibility Complex Class II DR Alpha (MHCDRa)

Sign In for Pricing
View Details