Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPCDC Rabbit Polyclonal Antibody (FITC)

PPCDC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CoaC, MDS018, PPC-DC

UniProt

Q96CD2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPCDC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068595

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC30A1, CT (SLC30A1, ZNT1, Zinc transporter 1, Solute carrier family 30 member 1) (MaxLight 405) discontinued
041896-ML405 100 µL

SLC30A1, CT (SLC30A1, ZNT1, Zinc transporter 1, Solute carrier family 30 member 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Lratd1 shRNA (UAS) - Lentiviral mouse Lratd1 shRNA (UAS, GFP) plasmid
GTR15280054 1 Vial

Lentiviral mouse Lratd1 shRNA (UAS) - Lentiviral mouse Lratd1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Purpurea glycoside B
orb1695568 25 mg

Purpurea glycoside B

Sign In for Pricing
View Details
Anti-GLI2 Antibody Picoband®, Dylight550 Conjugate
A00701-6-Dylight550 100 µg

Anti-GLI2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Recombinant Human Growth Differentiation Factor-15 antigen
NBP0131 1 mg

Recombinant Human Growth Differentiation Factor-15 antigen

Sign In for Pricing
View Details
Recombinant Corynebacterium ammoniagenes Riboflavin biosynthesis protein RibD (ribD)
MBS1031293-01 0.02 mg (E-Coli)

Recombinant Corynebacterium ammoniagenes Riboflavin biosynthesis protein RibD (ribD)

Sign In for Pricing
View Details