Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPCDC Rabbit Polyclonal Antibody (HRP)

PPCDC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CoaC, MDS018, PPC-DC

UniProt

Q96CD2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPCDC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068595

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Γ- (6-Aminohexyl) -ATP-ATTO-620
NU-833-620 80 µL

Γ- (6-Aminohexyl) -ATP-ATTO-620

Sign In for Pricing
View Details
NDUFB10 Mouse Monoclonal Antibody [Clone ID: LBI5C12]
AMM12980VCF 100 µg

NDUFB10 Mouse Monoclonal Antibody [Clone ID: LBI5C12]

Sign In for Pricing
View Details
CALHM2 Protein Lysate
OCOA10492-20UG 20 µg

CALHM2 Protein Lysate

Sign In for Pricing
View Details
RPL32P29 CRISPR All-in-one AAV vector set (with saCas9)(Human)
41433151 3x 1.0 µg DNA

RPL32P29 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rat Proteinase 3 (PRTN3) ELISA Kit
abx255951-01 96 Tests

Rat Proteinase 3 (PRTN3) ELISA Kit

Sign In for Pricing
View Details
Rat Proteinase 3 (PRTN3) ELISA Kit
abx255951-02 5x 96 Tests

Rat Proteinase 3 (PRTN3) ELISA Kit

Sign In for Pricing
View Details