Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt2 Rabbit Polyclonal Antibody (HRP)

Galnt2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D3ZFD2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Galnt2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRSPGSLIRLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099666

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK33, NT (STK33, Serine/threonine-protein kinase 33) (MaxLight 550) discontinued
042406-ML550 100 µL

STK33, NT (STK33, Serine/threonine-protein kinase 33) (MaxLight 550) discontinued

Sign In for Pricing
View Details
HOXB4 siRNA (Human)
CRH2200-01 15 nmol

HOXB4 siRNA (Human)

Sign In for Pricing
View Details
HOXB4 siRNA (Human)
CRH2200-02 30 nmol

HOXB4 siRNA (Human)

Sign In for Pricing
View Details
KLF11 Colorimetric Cell-Based ELISA Kit
MBS9500655-01 1 Kit

KLF11 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
KLF11 Colorimetric Cell-Based ELISA Kit
MBS9500655-02 5x 1 Kit

KLF11 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Anti-FGF11 Antibody Picoband®, Dylight594 Conjugate
A13819-2-Dylight594 100 µg

Anti-FGF11 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details