Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt2 Rabbit Polyclonal Antibody (HRP)

Galnt2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D3ZFD2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Galnt2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRSPGSLIRLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099666

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor B (FB, Complement Factor B, CFB, AHUS4, BF, BFD, C3/C5 Convertase, CFAB, FBI12, Glycine-rich beta Glycoprotein, GBG, H2-Bf, PBF2, Properdin Factor B) (FITC) discontinued
F0009-10C-FITC 100 µL

Factor B (FB, Complement Factor B, CFB, AHUS4, BF, BFD, C3/C5 Convertase, CFAB, FBI12, Glycine-rich beta Glycoprotein, GBG, H2-Bf, PBF2, Properdin Factor B) (FITC) discontinued

Sign In for Pricing
View Details
Dacomitinib Impurity 18
RM-D012218-01 10 mg

Dacomitinib Impurity 18

Sign In for Pricing
View Details
Dacomitinib Impurity 18
RM-D012218-02 25 mg

Dacomitinib Impurity 18

Sign In for Pricing
View Details
Dacomitinib Impurity 18
RM-D012218-03 50 mg

Dacomitinib Impurity 18

Sign In for Pricing
View Details
Dacomitinib Impurity 18
RM-D012218-04 100 mg

Dacomitinib Impurity 18

Sign In for Pricing
View Details
NFAT4/NF-ATc3/NFATC3/NF Rabbit Polyclonal Antibody (Fluoro550)
orb3109857 100 µg

NFAT4/NF-ATc3/NFATC3/NF Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details