Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN8 Rabbit Polyclonal Antibody (HRP)

TSPAN8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CO-029, TM4SF3

UniProt

P19075

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TSPAN8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_004607

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human APC2 shRNA (UAS) - Lentiviral human APC2 shRNA (UAS) plasmid
GTR15289939 1 Vial

Lentiviral human APC2 shRNA (UAS) - Lentiviral human APC2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
RGC32 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb971801 100 µL

RGC32 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Human ZBTB7B Recombinant Protein (N-His)
HT234012-01 50 µg

Human ZBTB7B Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human ZBTB7B Recombinant Protein (N-His)
HT234012-02 100 µg

Human ZBTB7B Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human ZBTB7B Recombinant Protein (N-His)
HT234012-03 1 mg

Human ZBTB7B Recombinant Protein (N-His)

Sign In for Pricing
View Details
Furaneol β-D-glucopyranoside
GC3407-5mg 5 mg

Furaneol β-D-glucopyranoside

Sign In for Pricing
View Details