Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhrs3 Rabbit Polyclonal Antibody (HRP)

Dhrs3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rs, retS, Rsdr1, retSDR1

UniProt

O88876

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035433

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5I Antibody, HRP conjugated
MBS1494914-01 0.05 mg

ATP5I Antibody, HRP conjugated

Sign In for Pricing
View Details
ATP5I Antibody, HRP conjugated
MBS1494914-02 0.1 mg

ATP5I Antibody, HRP conjugated

Sign In for Pricing
View Details
ATP5I Antibody, HRP conjugated
MBS1494914-03 5x 0.1 mg

ATP5I Antibody, HRP conjugated

Sign In for Pricing
View Details
TNKS1BP1 (NM_033396) Human Over-expression Lysate
LS085456-100ug 100 µg

TNKS1BP1 (NM_033396) Human Over-expression Lysate

Sign In for Pricing
View Details
PLentiCRISPRV2-U6-WWTR1 (human) -sgRNA1-EF1a-Cas9-P2A-Puro-WPRE
BZ34951 1 Vial

PLentiCRISPRV2-U6-WWTR1 (human) -sgRNA1-EF1a-Cas9-P2A-Puro-WPRE

Sign In for Pricing
View Details
Recombinant Rat TrkB / NTRK2 Protein (Fc tag)
ARP7124-01 10 µg

Recombinant Rat TrkB / NTRK2 Protein (Fc tag)

Sign In for Pricing
View Details