Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4galt6 Rabbit Polyclonal Antibody (FITC)

B4galt6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AA536803, AU022389

UniProt

Q9WVK5

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062711

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1X TAE (1L) Buffer Powder Packets (box of 50 packets)
#22031 50x 1 Each

1X TAE (1L) Buffer Powder Packets (box of 50 packets)

Sign In for Pricing
View Details
Lambda Light Chain Recombinant Mouse Monoclonal Antibody [A8G5-R]
HA601243 100 µL

Lambda Light Chain Recombinant Mouse Monoclonal Antibody [A8G5-R]

Sign In for Pricing
View Details
Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Recombinant Protein
TP303907L 1 mg

Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Recombinant Protein

Sign In for Pricing
View Details
SFRS5 (SRSF5) (NM_001039465) Human Over-expression Lysate
LC422050 20 µg

SFRS5 (SRSF5) (NM_001039465) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse NGAL/Lipocalin-2 Protein (Fc Tag)
PKSM041301-01 10 µg

Recombinant Mouse NGAL/Lipocalin-2 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse NGAL/Lipocalin-2 Protein (Fc Tag)
PKSM041301-02 50 µg

Recombinant Mouse NGAL/Lipocalin-2 Protein (Fc Tag)

Sign In for Pricing
View Details