Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4galt5 Rabbit Polyclonal Antibody (FITC)

B4galt5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AW049941, AW539721, 9430078I07Rik

UniProt

Q9JMK0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C3 (C3) (NM_000064) Human Over-expression Lysate
LC424934 20 µg

Complement C3 (C3) (NM_000064) Human Over-expression Lysate

Sign In for Pricing
View Details
SSH3BP1 (ABI1) Mouse Monoclonal Antibody [Clone ID: 1B9]
AM26490AF-N 100 µL

SSH3BP1 (ABI1) Mouse Monoclonal Antibody [Clone ID: 1B9]

Sign In for Pricing
View Details
PRDM1 Human Gene Knockout Kit (CRISPR)
KN217363RB 1 Kit

PRDM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human XIRP1 activation kit by CRISPRa
GA116134 1 Kit

Human XIRP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Pcdhga3 Mouse Monoclonal Antibody [Clone ID: N144/17]
75-177 100 µL

Pcdhga3 Mouse Monoclonal Antibody [Clone ID: N144/17]

Sign In for Pricing
View Details
Human SLCO4C1 activation kit by CRISPRa
GA117723 1 Kit

Human SLCO4C1 activation kit by CRISPRa

Sign In for Pricing
View Details