Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA4 Rabbit Polyclonal Antibody (Biotin)

PDIA4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERP70, ERP72, ERp-72

UniProt

P13667

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDIA4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004902

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Adenylate kinase isoenzyme 5 (AK5) ELISA Kit
MBS7248381-01 48 Well

Mouse Adenylate kinase isoenzyme 5 (AK5) ELISA Kit

Sign In for Pricing
View Details
Mouse Adenylate kinase isoenzyme 5 (AK5) ELISA Kit
MBS7248381-02 96 Well

Mouse Adenylate kinase isoenzyme 5 (AK5) ELISA Kit

Sign In for Pricing
View Details
Mouse Adenylate kinase isoenzyme 5 (AK5) ELISA Kit
MBS7248381-03 5x 96 Well

Mouse Adenylate kinase isoenzyme 5 (AK5) ELISA Kit

Sign In for Pricing
View Details
Mouse Adenylate kinase isoenzyme 5 (AK5) ELISA Kit
MBS7248381-04 10x 96 Well

Mouse Adenylate kinase isoenzyme 5 (AK5) ELISA Kit

Sign In for Pricing
View Details
Biotin Anti-Mouse MHC II (I-A/I-E) Antibody
JOT20049F 50μg

Biotin Anti-Mouse MHC II (I-A/I-E) Antibody

Sign In for Pricing
View Details
RecombinantIL-3, His, Rat
BK0242-01 10 µg

RecombinantIL-3, His, Rat

Sign In for Pricing
View Details