Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufb8 Rabbit Polyclonal Antibody (Biotin)

Ndufb8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CI-ASHI, AI987932, 2900010I05Rik

UniProt

Q9D6J5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Caproic anhydride 98%
C02430-01 250 g

N-Caproic anhydride 98%

Sign In for Pricing
View Details
N-Caproic anhydride 98%
C02430-02 1000 g

N-Caproic anhydride 98%

Sign In for Pricing
View Details
ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (HRP)
123342-HRP 100 µL

ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (HRP)

Sign In for Pricing
View Details
Sheep Histidine Rich Glycoprotein (HRG) ELISA Kit
MBS2104706-01 24 Strip Well

Sheep Histidine Rich Glycoprotein (HRG) ELISA Kit

Sign In for Pricing
View Details
Sheep Histidine Rich Glycoprotein (HRG) ELISA Kit
MBS2104706-02 48 Well

Sheep Histidine Rich Glycoprotein (HRG) ELISA Kit

Sign In for Pricing
View Details
Sheep Histidine Rich Glycoprotein (HRG) ELISA Kit
MBS2104706-03 96 Well

Sheep Histidine Rich Glycoprotein (HRG) ELISA Kit

Sign In for Pricing
View Details