Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufb8 Rabbit Polyclonal Antibody (HRP)

Ndufb8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CI-ASHI, AI987932, 2900010I05Rik

UniProt

Q9D6J5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken transient receptor potential cation channel, subfamily V, member 5 (TRPV5) ELISA Kit
MBS2612978-01 48 Well

Chicken transient receptor potential cation channel, subfamily V, member 5 (TRPV5) ELISA Kit

Sign In for Pricing
View Details
Chicken transient receptor potential cation channel, subfamily V, member 5 (TRPV5) ELISA Kit
MBS2612978-02 96 Well

Chicken transient receptor potential cation channel, subfamily V, member 5 (TRPV5) ELISA Kit

Sign In for Pricing
View Details
Chicken transient receptor potential cation channel, subfamily V, member 5 (TRPV5) ELISA Kit
MBS2612978-03 5x 96 Well

Chicken transient receptor potential cation channel, subfamily V, member 5 (TRPV5) ELISA Kit

Sign In for Pricing
View Details
Chicken transient receptor potential cation channel, subfamily V, member 5 (TRPV5) ELISA Kit
MBS2612978-04 10x 96 Well

Chicken transient receptor potential cation channel, subfamily V, member 5 (TRPV5) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human CCDC71 shRNA (UAS) - Lentiviral human CCDC71 shRNA (UAS, iRFP) plasmid
GTR15324655 1 Vial

Lentiviral human CCDC71 shRNA (UAS) - Lentiviral human CCDC71 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human APCDD1 Knockout HEK293T cell line
GTR15413430 1 Vial

Human APCDD1 Knockout HEK293T cell line

Sign In for Pricing
View Details