Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAS3 Rabbit Polyclonal Antibody (HRP)

HAS3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O00219

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HAS3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_619515

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD3B2 Rabbit Polyclonal Antibody
orb338821-01 30 µL

HSD3B2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSD3B2 Rabbit Polyclonal Antibody
orb338821-02 50 μL

HSD3B2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSD3B2 Rabbit Polyclonal Antibody
orb338821-03 100 µL

HSD3B2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSD3B2 Rabbit Polyclonal Antibody
orb338821-04 200 µL

HSD3B2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A UPF0442 protein yjjB (yjjB), partial
MBS7067441 Inquire

Recombinant Salmonella paratyphi A UPF0442 protein yjjB (yjjB), partial

Sign In for Pricing
View Details
TTC11/FIS1 Rabbit Polyclonal Antibody (Cy3)
orb2595660 100 µg

TTC11/FIS1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details