Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN1 Rabbit Polyclonal Antibody (FITC)

LMAN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MR60, gp58, F5F8D, FMFD1, MCFD1, ERGIC53, ERGIC-53

UniProt

P49257

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LMAN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frizzled 5 (FZD5) Human shRNA Plasmid Kit (Locus ID 7855)
TL312882 1 Kit

Frizzled 5 (FZD5) Human shRNA Plasmid Kit (Locus ID 7855)

Sign In for Pricing
View Details
CRH cDNA Clone
MBS1267090-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

CRH cDNA Clone

Sign In for Pricing
View Details
CRH cDNA Clone
MBS1267090-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

CRH cDNA Clone

Sign In for Pricing
View Details
Timm21 Mouse qPCR Template Standard (NM_025969)
MK204673 1 Kit

Timm21 Mouse qPCR Template Standard (NM_025969)

Sign In for Pricing
View Details
Olr200 (NM_001000189) Rat Tagged ORF Clone Lentiviral Particle
RR201978L4V 200 µL

Olr200 (NM_001000189) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
(S) -DMT-glycidol-uracil
TNU1543-01 10 mg

(S) -DMT-glycidol-uracil

Sign In for Pricing
View Details