Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN1 Rabbit Polyclonal Antibody (HRP)

LMAN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MR60, gp58, F5F8D, FMFD1, MCFD1, ERGIC53, ERGIC-53

UniProt

P49257

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LMAN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SCEL Polyclonal Antibody
PHB55501 100 μg

Anti-SCEL Polyclonal Antibody

Sign In for Pricing
View Details
V (D) J recombination-activating protein 2
orb1637573-01 50 µg

V (D) J recombination-activating protein 2

Sign In for Pricing
View Details
V (D) J recombination-activating protein 2
orb1637573-02 100 µg

V (D) J recombination-activating protein 2

Sign In for Pricing
View Details
V (D) J recombination-activating protein 2
orb1637573-03 1 mg

V (D) J recombination-activating protein 2

Sign In for Pricing
View Details
Rat ALP (Alkaline Phosphatase) ELISA Kit
ER21897 96 Tests

Rat ALP (Alkaline Phosphatase) ELISA Kit

Sign In for Pricing
View Details
NT5C3 Rabbit Polyclonal Antibody (BF750)
orb2468888 100 µL

NT5C3 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details